NDUFV2 monoclonal antibody (M03), clone 1A10
  • NDUFV2 monoclonal antibody (M03), clone 1A10

NDUFV2 monoclonal antibody (M03), clone 1A10

Ref: AB-H00004729-M03
NDUFV2 monoclonal antibody (M03), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDUFV2.
Información adicional
Size 100 ug
Gene Name NDUFV2
Gene Alias -
Gene Description NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq EAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFV2 (NP_066552, 150 a.a. ~ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4729
Clone Number 1A10
Iso type IgG2a Kappa

Enviar un mensaje


NDUFV2 monoclonal antibody (M03), clone 1A10

NDUFV2 monoclonal antibody (M03), clone 1A10