NDUFS4 MaxPab mouse polyclonal antibody (B01P)
  • NDUFS4 MaxPab mouse polyclonal antibody (B01P)

NDUFS4 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004724-B01P
NDUFS4 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NDUFS4 protein.
Información adicional
Size 50 ug
Gene Name NDUFS4
Gene Alias AQDQ
Gene Description NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFS4 (NP_002486.1, 1 a.a. ~ 175 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4724

Enviar un mensaje


NDUFS4 MaxPab mouse polyclonal antibody (B01P)

NDUFS4 MaxPab mouse polyclonal antibody (B01P)