NDUFV1 polyclonal antibody (A01)
  • NDUFV1 polyclonal antibody (A01)

NDUFV1 polyclonal antibody (A01)

Ref: AB-H00004723-A01
NDUFV1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NDUFV1.
Información adicional
Size 50 uL
Gene Name NDUFV1
Gene Alias CI-51kD|UQOR1
Gene Description NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFV1 (NP_002466, 365 a.a. ~ 464 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4723

Enviar un mensaje


NDUFV1 polyclonal antibody (A01)

NDUFV1 polyclonal antibody (A01)