NDUFC2 purified MaxPab rabbit polyclonal antibody (D01P)
  • NDUFC2 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFC2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004718-D01P
NDUFC2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDUFC2 protein.
Información adicional
Size 100 ug
Gene Name NDUFC2
Gene Alias B14.5b|NADHDH2
Gene Description NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFC2 (NP_004540.1, 1 a.a. ~ 119 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4718

Enviar un mensaje


NDUFC2 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFC2 purified MaxPab rabbit polyclonal antibody (D01P)