NDUFB7 monoclonal antibody (M01), clone 4D4
  • NDUFB7 monoclonal antibody (M01), clone 4D4

NDUFB7 monoclonal antibody (M01), clone 4D4

Ref: AB-H00004713-M01
NDUFB7 monoclonal antibody (M01), clone 4D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDUFB7.
Información adicional
Size 100 ug
Gene Name NDUFB7
Gene Alias B18|CI-B18|MGC2480
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq EMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFB7 (NP_004137, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4713
Clone Number 4D4
Iso type IgG2a Kappa

Enviar un mensaje


NDUFB7 monoclonal antibody (M01), clone 4D4

NDUFB7 monoclonal antibody (M01), clone 4D4