NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)
  • NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004712-D01P
NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDUFB6 protein.
Información adicional
Size 100 ug
Gene Name NDUFB6
Gene Alias B17|CI|MGC13675
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFB6 (NP_002484.1, 1 a.a. ~ 128 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4712

Enviar un mensaje


NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)