NDUFAB1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NDUFAB1 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFAB1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004706-D01P
NDUFAB1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDUFAB1 protein.
Información adicional
Size 100 ug
Gene Name NDUFAB1
Gene Alias ACP|FASN2A|MGC65095|SDAP
Gene Description NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFAB1 (NP_004994.1, 1 a.a. ~ 156 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4706

Enviar un mensaje


NDUFAB1 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFAB1 purified MaxPab rabbit polyclonal antibody (D01P)