NDUFA9 monoclonal antibody (M01), clone 3D7
  • NDUFA9 monoclonal antibody (M01), clone 3D7

NDUFA9 monoclonal antibody (M01), clone 3D7

Ref: AB-H00004704-M01
NDUFA9 monoclonal antibody (M01), clone 3D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDUFA9.
Información adicional
Size 100 ug
Gene Name NDUFA9
Gene Alias MGC111043|NDUFS2L|SDR22E1
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFA9 (NP_004993, 303 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4704
Clone Number 3D7
Iso type IgG2a Kappa

Enviar un mensaje


NDUFA9 monoclonal antibody (M01), clone 3D7

NDUFA9 monoclonal antibody (M01), clone 3D7