NDUFA2 monoclonal antibody (M01), clone 6E7
  • NDUFA2 monoclonal antibody (M01), clone 6E7

NDUFA2 monoclonal antibody (M01), clone 6E7

Ref: AB-H00004695-M01
NDUFA2 monoclonal antibody (M01), clone 6E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDUFA2.
Información adicional
Size 100 ug
Gene Name NDUFA2
Gene Alias B8|CD14
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFA2 (NP_002479, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4695
Clone Number 6E7
Iso type IgG1 Kappa

Enviar un mensaje


NDUFA2 monoclonal antibody (M01), clone 6E7

NDUFA2 monoclonal antibody (M01), clone 6E7