NDUFA2 polyclonal antibody (A01)
  • NDUFA2 polyclonal antibody (A01)

NDUFA2 polyclonal antibody (A01)

Ref: AB-H00004695-A01
NDUFA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NDUFA2.
Información adicional
Size 50 uL
Gene Name NDUFA2
Gene Alias B8|CD14
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFA2 (NP_002479, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4695

Enviar un mensaje


NDUFA2 polyclonal antibody (A01)

NDUFA2 polyclonal antibody (A01)