AB-H00004694-M01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | NDUFA1 |
Gene Alias | CI-MWFE|MWFE|ZNF183 |
Gene Description | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Re,ELISA |
Immunogen Prot. Seq | AYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | NDUFA1 (AAH00266, 24 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 4694 |
Clone Number | 3B9-1A1 |
Iso type | IgG1 kappa |