NDUFA1 monoclonal antibody (M01), clone 3B9-1A1
  • NDUFA1 monoclonal antibody (M01), clone 3B9-1A1

NDUFA1 monoclonal antibody (M01), clone 3B9-1A1

Ref: AB-H00004694-M01
NDUFA1 monoclonal antibody (M01), clone 3B9-1A1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NDUFA1.
Información adicional
Size 100 ug
Gene Name NDUFA1
Gene Alias CI-MWFE|MWFE|ZNF183
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFA1 (AAH00266, 24 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4694
Clone Number 3B9-1A1
Iso type IgG1 kappa

Enviar un mensaje


NDUFA1 monoclonal antibody (M01), clone 3B9-1A1

NDUFA1 monoclonal antibody (M01), clone 3B9-1A1