NDUFA1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NDUFA1 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFA1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004694-D01P
NDUFA1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDUFA1 protein.
Información adicional
Size 100 ug
Gene Name NDUFA1
Gene Alias CI-MWFE|MWFE|ZNF183
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFA1 (AAH00266.1, 1 a.a. ~ 70 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4694

Enviar un mensaje


NDUFA1 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFA1 purified MaxPab rabbit polyclonal antibody (D01P)