NCL purified MaxPab rabbit polyclonal antibody (D01P)
  • NCL purified MaxPab rabbit polyclonal antibody (D01P)

NCL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004691-D01P
NCL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NCL protein.
Información adicional
Size 100 ug
Gene Name NCL
Gene Alias C23|FLJ45706
Gene Description nucleolin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDED
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NCL (NP_005372.2, 1 a.a. ~ 710 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4691

Enviar un mensaje


NCL purified MaxPab rabbit polyclonal antibody (D01P)

NCL purified MaxPab rabbit polyclonal antibody (D01P)