NCK1 monoclonal antibody (M01), clone 1A1
  • NCK1 monoclonal antibody (M01), clone 1A1

NCK1 monoclonal antibody (M01), clone 1A1

Ref: AB-H00004690-M01
NCK1 monoclonal antibody (M01), clone 1A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NCK1.
Información adicional
Size 100 ug
Gene Name NCK1
Gene Alias MGC12668|NCK|NCKalpha
Gene Description NCK adaptor protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCK1 (AAH06403, 185 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4690
Clone Number 1A1
Iso type IgG1 Kappa

Enviar un mensaje


NCK1 monoclonal antibody (M01), clone 1A1

NCK1 monoclonal antibody (M01), clone 1A1