NCF4 purified MaxPab rabbit polyclonal antibody (D01P)
  • NCF4 purified MaxPab rabbit polyclonal antibody (D01P)

NCF4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004689-D01P
NCF4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NCF4 protein.
Información adicional
Size 100 ug
Gene Name NCF4
Gene Alias MGC3810|NCF|P40PHOX|SH3PXD4
Gene Description neutrophil cytosolic factor 4, 40kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NCF4 (NP_000622.2, 1 a.a. ~ 339 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4689

Enviar un mensaje


NCF4 purified MaxPab rabbit polyclonal antibody (D01P)

NCF4 purified MaxPab rabbit polyclonal antibody (D01P)