NCF4 polyclonal antibody (A01)
  • NCF4 polyclonal antibody (A01)

NCF4 polyclonal antibody (A01)

Ref: AB-H00004689-A01
NCF4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NCF4.
Información adicional
Size 50 uL
Gene Name NCF4
Gene Alias MGC3810|NCF|P40PHOX|SH3PXD4
Gene Description neutrophil cytosolic factor 4, 40kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCF4 (AAH02798, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4689

Enviar un mensaje


NCF4 polyclonal antibody (A01)

NCF4 polyclonal antibody (A01)