NCBP1 monoclonal antibody (M04), clone 1E9
  • NCBP1 monoclonal antibody (M04), clone 1E9

NCBP1 monoclonal antibody (M04), clone 1E9

Ref: AB-H00004686-M04
NCBP1 monoclonal antibody (M04), clone 1E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NCBP1.
Información adicional
Size 100 ug
Gene Name NCBP1
Gene Alias CBP80|MGC2087|NCBP
Gene Description nuclear cap binding protein subunit 1, 80kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCBP1 (NP_002477, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4686
Clone Number 1E9
Iso type IgG2b Kappa

Enviar un mensaje


NCBP1 monoclonal antibody (M04), clone 1E9

NCBP1 monoclonal antibody (M04), clone 1E9