NCAM1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NCAM1 purified MaxPab rabbit polyclonal antibody (D01P)

NCAM1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004684-D01P
NCAM1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NCAM1 protein.
Información adicional
Size 100 ug
Gene Name NCAM1
Gene Alias CD56|MSK39|NCAM
Gene Description neural cell adhesion molecule 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NCAM1 (AAH47244.1, 1 a.a. ~ 858 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4684

Enviar un mensaje


NCAM1 purified MaxPab rabbit polyclonal antibody (D01P)

NCAM1 purified MaxPab rabbit polyclonal antibody (D01P)