NBN monoclonal antibody (M01), clone 3E4
  • NBN monoclonal antibody (M01), clone 3E4

NBN monoclonal antibody (M01), clone 3E4

Ref: AB-H00004683-M01
NBN monoclonal antibody (M01), clone 3E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NBN.
Información adicional
Size 100 ug
Gene Name NBN
Gene Alias AT-V1|AT-V2|ATV|FLJ10155|MGC87362|NBS|NBS1|P95
Gene Description nibrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NBN (NP_002476, 645 a.a. ~ 754 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4683
Clone Number 3E4
Iso type IgG2a Kappa

Enviar un mensaje


NBN monoclonal antibody (M01), clone 3E4

NBN monoclonal antibody (M01), clone 3E4