NARS monoclonal antibody (M01), clone 2D6
  • NARS monoclonal antibody (M01), clone 2D6

NARS monoclonal antibody (M01), clone 2D6

Ref: AB-H00004677-M01
NARS monoclonal antibody (M01), clone 2D6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NARS.
Información adicional
Size 100 ug
Gene Name NARS
Gene Alias ASNRS|NARS1
Gene Description asparaginyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NARS (AAH01687, 1 a.a. ~ 548 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4677
Clone Number 2D6
Iso type IgG2a Kappa

Enviar un mensaje


NARS monoclonal antibody (M01), clone 2D6

NARS monoclonal antibody (M01), clone 2D6