NAP1L4 polyclonal antibody (A01)
  • NAP1L4 polyclonal antibody (A01)

NAP1L4 polyclonal antibody (A01)

Ref: AB-H00004676-A01
NAP1L4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NAP1L4.
Información adicional
Size 50 uL
Gene Name NAP1L4
Gene Alias MGC4565|NAP2|NAP2L|hNAP2
Gene Description nucleosome assembly protein 1-like 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NAP1L4 (NP_005960, 1 a.a. ~ 82 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4676

Enviar un mensaje


NAP1L4 polyclonal antibody (A01)

NAP1L4 polyclonal antibody (A01)