NAP1L3 MaxPab rabbit polyclonal antibody (D01)
  • NAP1L3 MaxPab rabbit polyclonal antibody (D01)

NAP1L3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004675-D01
NAP1L3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NAP1L3 protein.
Información adicional
Size 100 uL
Gene Name NAP1L3
Gene Alias MB20|MGC26312|NPL3
Gene Description nucleosome assembly protein 1-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP,IF
Immunogen Prot. Seq MAEADFKMVSEPVAHGVAEEEMASSTSDSGEESDSSSSSSSTSDSSSSSSTSGSSSGSGSSSSSSGSTSSRSRLYRKKRVPEPSRRARRAPLGTNFVDRLPQAVRNRVQALRNIQDECDKVDTLFLKAIHDLERKYAELNKPLYDRRFQIINAEYEPTEEECEWNSEDEEFSSDEEVQDNTPSEMPPLEGEEEENPKENPEVKAEEKEVPKEIPEVKDEEKEVAKEITEVKAEEKADSKDCMEATPEVKEDPKEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NAP1L3 (AAH34954.1, 1 a.a. ~ 506 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4675

Enviar un mensaje


NAP1L3 MaxPab rabbit polyclonal antibody (D01)

NAP1L3 MaxPab rabbit polyclonal antibody (D01)