NAGA purified MaxPab mouse polyclonal antibody (B01P)
  • NAGA purified MaxPab mouse polyclonal antibody (B01P)

NAGA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004668-B01P
NAGA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NAGA protein.
Información adicional
Size 50 ug
Gene Name NAGA
Gene Alias D22S674|GALB
Gene Description N-acetylgalactosaminidase, alpha-
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLLKTVLLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NAGA (NP_000253.1, 1 a.a. ~ 411 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4668

Enviar un mensaje


NAGA purified MaxPab mouse polyclonal antibody (B01P)

NAGA purified MaxPab mouse polyclonal antibody (B01P)