NAB2 MaxPab rabbit polyclonal antibody (D01)
  • NAB2 MaxPab rabbit polyclonal antibody (D01)

NAB2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004665-D01
NAB2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NAB2 protein.
Información adicional
Size 100 uL
Gene Name NAB2
Gene Alias MADER|MGC75085
Gene Description NGFI-A binding protein 2 (EGR1 binding protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSRWDWGWSRPTGARDGTPACLGRVWMDICRLWGHVQG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NAB2 (AAH07756.1, 1 a.a. ~ 241 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4665

Enviar un mensaje


NAB2 MaxPab rabbit polyclonal antibody (D01)

NAB2 MaxPab rabbit polyclonal antibody (D01)