MYT1 monoclonal antibody (M02), clone 2A7
  • MYT1 monoclonal antibody (M02), clone 2A7

MYT1 monoclonal antibody (M02), clone 2A7

Ref: AB-H00004661-M02
MYT1 monoclonal antibody (M02), clone 2A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MYT1.
Información adicional
Size 100 ug
Gene Name MYT1
Gene Alias C20orf36|MTF1|MYTI|PLPB1
Gene Description myelin transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYT1 (NP_004526, 586 a.a. ~ 685 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4661
Clone Number 2A7
Iso type IgG2a Lambda

Enviar un mensaje


MYT1 monoclonal antibody (M02), clone 2A7

MYT1 monoclonal antibody (M02), clone 2A7