MYT1 polyclonal antibody (A01)
  • MYT1 polyclonal antibody (A01)

MYT1 polyclonal antibody (A01)

Ref: AB-H00004661-A01
MYT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MYT1.
Información adicional
Size 50 uL
Gene Name MYT1
Gene Alias C20orf36|MTF1|MYTI|PLPB1
Gene Description myelin transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYT1 (NP_004526, 586 a.a. ~ 685 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4661

Enviar un mensaje


MYT1 polyclonal antibody (A01)

MYT1 polyclonal antibody (A01)