MYO1E monoclonal antibody (M02), clone 7A5
  • MYO1E monoclonal antibody (M02), clone 7A5

MYO1E monoclonal antibody (M02), clone 7A5

Ref: AB-H00004643-M02
MYO1E monoclonal antibody (M02), clone 7A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MYO1E.
Información adicional
Size 100 ug
Gene Name MYO1E
Gene Alias HuncM-IC|MGC104638|MYO1C
Gene Description myosin IE
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYO1E (NP_004989.2, 918 a.a. ~ 1014 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4643
Clone Number 7A5
Iso type IgG2a Kappa

Enviar un mensaje


MYO1E monoclonal antibody (M02), clone 7A5

MYO1E monoclonal antibody (M02), clone 7A5