MYLK purified MaxPab mouse polyclonal antibody (B01P)
  • MYLK purified MaxPab mouse polyclonal antibody (B01P)

MYLK purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004638-B01P
MYLK purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MYLK protein.
Información adicional
Size 50 ug
Gene Name MYLK
Gene Alias DKFZp686I10125|FLJ12216|KRP|MLCK|MLCK1|MLCK108|MLCK210|MSTP083|MYLK1|smMLCK
Gene Description myosin light chain kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MYLK (ENSP00000355024, 1 a.a. ~ 992 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4638

Enviar un mensaje


MYLK purified MaxPab mouse polyclonal antibody (B01P)

MYLK purified MaxPab mouse polyclonal antibody (B01P)