MYL5 monoclonal antibody (M01), clone 1C5
  • MYL5 monoclonal antibody (M01), clone 1C5

MYL5 monoclonal antibody (M01), clone 1C5

Ref: AB-H00004636-M01
MYL5 monoclonal antibody (M01), clone 1C5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant MYL5.
Información adicional
Size 100 ug
Gene Name MYL5
Gene Alias -
Gene Description myosin, light chain 5, regulatory
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYL5 (AAH40050.1, 1 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4636
Clone Number 1C5
Iso type IgG2a Kappa

Enviar un mensaje


MYL5 monoclonal antibody (M01), clone 1C5

MYL5 monoclonal antibody (M01), clone 1C5