MYL4 monoclonal antibody (M01), clone 1A11-C8
  • MYL4 monoclonal antibody (M01), clone 1A11-C8

MYL4 monoclonal antibody (M01), clone 1A11-C8

Ref: AB-H00004635-M01
MYL4 monoclonal antibody (M01), clone 1A11-C8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant MYL4.
Información adicional
Size 100 ug
Gene Name MYL4
Gene Alias ALC1|AMLC|GT1|PRO1957
Gene Description myosin, light chain 4, alkali
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYL4 (AAH30228, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4635
Clone Number 1A11-C8
Iso type IgG1 Kappa

Enviar un mensaje


MYL4 monoclonal antibody (M01), clone 1A11-C8

MYL4 monoclonal antibody (M01), clone 1A11-C8