MYL4 MaxPab mouse polyclonal antibody (B01)
  • MYL4 MaxPab mouse polyclonal antibody (B01)

MYL4 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00004635-B01
MYL4 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human MYL4 protein.
Información adicional
Size 50 uL
Gene Name MYL4
Gene Alias ALC1|AMLC|GT1|PRO1957
Gene Description myosin, light chain 4, alkali
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MYL4 (NP_001002841.1, 1 a.a. ~ 197 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4635

Enviar un mensaje


MYL4 MaxPab mouse polyclonal antibody (B01)

MYL4 MaxPab mouse polyclonal antibody (B01)