MYF6 monoclonal antibody (M05), clone 1H3
  • MYF6 monoclonal antibody (M05), clone 1H3

MYF6 monoclonal antibody (M05), clone 1H3

Ref: AB-H00004618-M05
MYF6 monoclonal antibody (M05), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MYF6.
Información adicional
Size 100 ug
Gene Name MYF6
Gene Alias MRF4|bHLHc4
Gene Description myogenic factor 6 (herculin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYF6 (NP_002460.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4618
Clone Number 1H3
Iso type IgG2a Kappa

Enviar un mensaje


MYF6 monoclonal antibody (M05), clone 1H3

MYF6 monoclonal antibody (M05), clone 1H3