MYF6 purified MaxPab mouse polyclonal antibody (B02P)
  • MYF6 purified MaxPab mouse polyclonal antibody (B02P)

MYF6 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00004618-B02P
MYF6 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MYF6 protein.
Información adicional
Size 50 ug
Gene Name MYF6
Gene Alias MRF4|bHLHc4
Gene Description myogenic factor 6 (herculin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MYF6 (NP_002460.1, 1 a.a. ~ 242 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4618

Enviar un mensaje


MYF6 purified MaxPab mouse polyclonal antibody (B02P)

MYF6 purified MaxPab mouse polyclonal antibody (B02P)