MYD88 purified MaxPab rabbit polyclonal antibody (D01P)
  • MYD88 purified MaxPab rabbit polyclonal antibody (D01P)

MYD88 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004615-D01P
MYD88 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MYD88 protein.
Información adicional
Size 100 ug
Gene Name MYD88
Gene Alias MYD88D
Gene Description myeloid differentiation primary response gene (88)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MYD88 (NP_002459.1, 1 a.a. ~ 296 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4615

Enviar un mensaje


MYD88 purified MaxPab rabbit polyclonal antibody (D01P)

MYD88 purified MaxPab rabbit polyclonal antibody (D01P)