MYCN monoclonal antibody (M01), clone 3H4
  • MYCN monoclonal antibody (M01), clone 3H4

MYCN monoclonal antibody (M01), clone 3H4

Ref: AB-H00004613-M01
MYCN monoclonal antibody (M01), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MYCN.
Información adicional
Size 100 ug
Gene Name MYCN
Gene Alias MODED|N-myc|NMYC|ODED|bHLHe37
Gene Description v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYCN (NP_005369, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4613
Clone Number 3H4
Iso type IgG2a Kappa

Enviar un mensaje


MYCN monoclonal antibody (M01), clone 3H4

MYCN monoclonal antibody (M01), clone 3H4