MYCN purified MaxPab rabbit polyclonal antibody (D01P)
  • MYCN purified MaxPab rabbit polyclonal antibody (D01P)

MYCN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004613-D01P
MYCN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MYCN protein.
Información adicional
Size 100 ug
Gene Name MYCN
Gene Alias MODED|N-myc|NMYC|ODED|bHLHe37
Gene Description v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MYCN (NP_005369.2, 1 a.a. ~ 464 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4613

Enviar un mensaje


MYCN purified MaxPab rabbit polyclonal antibody (D01P)

MYCN purified MaxPab rabbit polyclonal antibody (D01P)