MYBL2 monoclonal antibody (M02), clone 1C7
  • MYBL2 monoclonal antibody (M02), clone 1C7

MYBL2 monoclonal antibody (M02), clone 1C7

Ref: AB-H00004605-M02
MYBL2 monoclonal antibody (M02), clone 1C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MYBL2.
Información adicional
Size 100 ug
Gene Name MYBL2
Gene Alias B-MYB|BMYB|MGC15600
Gene Description v-myb myeloblastosis viral oncogene homolog (avian)-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYBL2 (AAH53555, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4605
Clone Number 1C7
Iso type IgG1 Kappa

Enviar un mensaje


MYBL2 monoclonal antibody (M02), clone 1C7

MYBL2 monoclonal antibody (M02), clone 1C7