MVD purified MaxPab mouse polyclonal antibody (B02P)
  • MVD purified MaxPab mouse polyclonal antibody (B02P)

MVD purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00004597-B02P
MVD purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MVD protein.
Información adicional
Size 50 ug
Gene Name MVD
Gene Alias FP17780|MPD
Gene Description mevalonate (diphospho) decarboxylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACLAYTLARVYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEMARCIRERDFPSFAQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MVD (NP_002452.1, 1 a.a. ~ 400 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4597

Enviar un mensaje


MVD purified MaxPab mouse polyclonal antibody (B02P)

MVD purified MaxPab mouse polyclonal antibody (B02P)