MUT purified MaxPab mouse polyclonal antibody (B01P)
  • MUT purified MaxPab mouse polyclonal antibody (B01P)

MUT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004594-B01P
MUT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MUT protein.
Información adicional
Size 50 ug
Gene Name MUT
Gene Alias MCM
Gene Description methylmalonyl Coenzyme A mutase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MUT (AAH16282.1, 1 a.a. ~ 750 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4594

Enviar un mensaje


MUT purified MaxPab mouse polyclonal antibody (B01P)

MUT purified MaxPab mouse polyclonal antibody (B01P)