MUC7 polyclonal antibody (A01)
  • MUC7 polyclonal antibody (A01)

MUC7 polyclonal antibody (A01)

Ref: AB-H00004589-A01
MUC7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MUC7.
Información adicional
Size 50 uL
Gene Name MUC7
Gene Alias DKFZp686J03256|FLJ27047|MG2|MGC34772
Gene Description mucin 7, secreted
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MUC7 (NP_689504, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4589

Enviar un mensaje


MUC7 polyclonal antibody (A01)

MUC7 polyclonal antibody (A01)