MUC2 monoclonal antibody (M08), clone 1H2
  • MUC2 monoclonal antibody (M08), clone 1H2

MUC2 monoclonal antibody (M08), clone 1H2

Ref: AB-H00004583-M08
MUC2 monoclonal antibody (M08), clone 1H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MUC2.
Información adicional
Size 100 ug
Gene Name MUC2
Gene Alias MLP|SMUC
Gene Description mucin 2, oligomeric mucus/gel-forming
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MUC2 (NP_002448, 5081 a.a. ~ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4583
Clone Number 1H2
Iso type IgG2b Kappa

Enviar un mensaje


MUC2 monoclonal antibody (M08), clone 1H2

MUC2 monoclonal antibody (M08), clone 1H2