MTRR monoclonal antibody (M01), clone 1G7
  • MTRR monoclonal antibody (M01), clone 1G7

MTRR monoclonal antibody (M01), clone 1G7

Ref: AB-H00004552-M01
MTRR monoclonal antibody (M01), clone 1G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MTRR.
Información adicional
Size 100 ug
Gene Name MTRR
Gene Alias MGC129643|MSR
Gene Description 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MRRFLLLYATQQGQAKAIAEEMCEQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTRR (NP_002445, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4552
Clone Number 1G7
Iso type IgG2a Kappa

Enviar un mensaje


MTRR monoclonal antibody (M01), clone 1G7

MTRR monoclonal antibody (M01), clone 1G7