ND1 polyclonal antibody (A01)
  • ND1 polyclonal antibody (A01)

ND1 polyclonal antibody (A01)

Ref: AB-H00004535-A01
ND1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ND1.
Información adicional
Size 50 uL
Gene Name ND1
Gene Alias MTND1
Gene Description NADH dehydrogenase, subunit 1 (complex I)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MLTERKILGYIQLRKGPNVVGPYGLLQPFADAIKLFTKEPLKPATSTITLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ND1 (YP_003024026, 21 a.a. ~ 71 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4535

Enviar un mensaje


ND1 polyclonal antibody (A01)

ND1 polyclonal antibody (A01)