NUDT1 monoclonal antibody (M02), clone 5F11
  • NUDT1 monoclonal antibody (M02), clone 5F11

NUDT1 monoclonal antibody (M02), clone 5F11

Ref: AB-H00004521-M02
NUDT1 monoclonal antibody (M02), clone 5F11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NUDT1.
Información adicional
Size 100 ug
Gene Name NUDT1
Gene Alias MTH1
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUDT1 (AAH14618, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4521
Clone Number 5F11
Iso type IgG2a Kappa

Enviar un mensaje


NUDT1 monoclonal antibody (M02), clone 5F11

NUDT1 monoclonal antibody (M02), clone 5F11