MTF1 monoclonal antibody (M07A), clone 4A5
  • MTF1 monoclonal antibody (M07A), clone 4A5

MTF1 monoclonal antibody (M07A), clone 4A5

Ref: AB-H00004520-M07A
MTF1 monoclonal antibody (M07A), clone 4A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MTF1.
Información adicional
Size 200 uL
Gene Name MTF1
Gene Alias MGC23036|MTF-1|ZRF
Gene Description metal-regulatory transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTF1 (NP_005946, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 4520
Clone Number 4A5
Iso type IgM Kappa

Enviar un mensaje


MTF1 monoclonal antibody (M07A), clone 4A5

MTF1 monoclonal antibody (M07A), clone 4A5