MTF1 monoclonal antibody (M06), clone 3G12
  • MTF1 monoclonal antibody (M06), clone 3G12

MTF1 monoclonal antibody (M06), clone 3G12

Ref: AB-H00004520-M06
MTF1 monoclonal antibody (M06), clone 3G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MTF1.
Información adicional
Size 100 ug
Gene Name MTF1
Gene Alias MGC23036|MTF-1|ZRF
Gene Description metal-regulatory transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTF1 (NP_005946, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4520
Clone Number 3G12
Iso type IgG2a Kappa

Enviar un mensaje


MTF1 monoclonal antibody (M06), clone 3G12

MTF1 monoclonal antibody (M06), clone 3G12