MTCP1 MaxPab mouse polyclonal antibody (B02P)
  • MTCP1 MaxPab mouse polyclonal antibody (B02P)

MTCP1 MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00004515-B02P
MTCP1 MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MTCP1 protein.
Información adicional
Size 50 ug
Gene Name MTCP1
Gene Alias C6.1B|P13MTCP1
Gene Description mature T-cell proliferation 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MTCP1 (NP_001018024, 1 a.a. ~ 68 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4515

Enviar un mensaje


MTCP1 MaxPab mouse polyclonal antibody (B02P)

MTCP1 MaxPab mouse polyclonal antibody (B02P)