MSX1 purified MaxPab rabbit polyclonal antibody (D01P)
  • MSX1 purified MaxPab rabbit polyclonal antibody (D01P)

MSX1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004487-D01P
MSX1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MSX1 protein.
Información adicional
Size 100 ug
Gene Name MSX1
Gene Alias HOX7|HYD1
Gene Description msh homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MSX1 (AAH67353.1, 1 a.a. ~ 297 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4487

Enviar un mensaje


MSX1 purified MaxPab rabbit polyclonal antibody (D01P)

MSX1 purified MaxPab rabbit polyclonal antibody (D01P)