MST1 monoclonal antibody (M04), clone 3B5
  • MST1 monoclonal antibody (M04), clone 3B5

MST1 monoclonal antibody (M04), clone 3B5

Ref: AB-H00004485-M04
MST1 monoclonal antibody (M04), clone 3B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MST1.
Información adicional
Size 100 ug
Gene Name MST1
Gene Alias D3F15S2|DNF15S2|HGFL|MSP|NF15S2
Gene Description macrophage stimulating 1 (hepatocyte growth factor-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MST1 (AAH48330, 19 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4485
Clone Number 3B5
Iso type IgG1 Kappa

Enviar un mensaje


MST1 monoclonal antibody (M04), clone 3B5

MST1 monoclonal antibody (M04), clone 3B5