MST1 purified MaxPab rabbit polyclonal antibody (D01P)
  • MST1 purified MaxPab rabbit polyclonal antibody (D01P)

MST1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004485-D01P
MST1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MST1 protein.
Información adicional
Size 100 ug
Gene Name MST1
Gene Alias D3F15S2|DNF15S2|HGFL|MSP|NF15S2
Gene Description macrophage stimulating 1 (hepatocyte growth factor-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRGTMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYCRNPDGSERPWCYTTD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MST1 (NP_066278.2, 1 a.a. ~ 711 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4485

Enviar un mensaje


MST1 purified MaxPab rabbit polyclonal antibody (D01P)

MST1 purified MaxPab rabbit polyclonal antibody (D01P)